PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001180-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 289aa    MW: 31269.3 Da    PI: 9.5863
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001180-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-09651344
                     SS-HHHHHHHHHHHH.HTTTT....-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavk.qlGgg....tWktIartmgkgRtlkqcksrw 44
                      W+ eE++ + +a++ q+Ggg    +W++Ia++++  +tl ++k ++
    NNU_001180-RA  6 GWSREEEKAFENAIAvQWGGGdsnnRWEKIASMVP-SKTLADLKKHY 51
                     6*************8688988**************.**********9 PP

2Myb_DNA-binding391.9e-12129173347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
    NNU_001180-RA 129 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 173
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.562159IPR017884SANT domain
SMARTSM007172.9E-5357IPR001005SANT/Myb domain
PfamPF002494.4E-6551IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-4553IPR009057Homeodomain-like
SuperFamilySSF466891.17E-8662IPR009057Homeodomain-like
CDDcd001671.62E-8751No hitNo description
PROSITE profilePS5129417.282121178IPR017930Myb domain
SuperFamilySSF466896.7E-17124179IPR009057Homeodomain-like
SMARTSM007172.3E-10126176IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.9E-17126176IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.1E-11127172IPR009057Homeodomain-like
CDDcd001679.09E-10129174No hitNo description
PfamPF002497.0E-11129173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MASVGGWSRE EEKAFENAIA VQWGGGDSNN RWEKIASMVP SKTLADLKKH YEILVEDVDA  60
IEAGRIPIPT YVKDEAASKD QNVIPPAGSA DRRLNCNFGT GFSGLGSDSG GQGGKAGSRS  120
DQERRKGIPW TEEEHRLFLL GLDKFGKGDW RSISRNFVIS RTPTQVASHA QKYFIRLNSM  180
NRDRRRSSIH DITSVNSGDV SSPQAPITGQ QPHTTPTAAT PAAVKHRPPQ PNMPAVGMYG  240
PPIGQPVAAP PPHMVSAVGT PVMLPPGHHP HPPYMVPMAY PVAPPTMHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-14171173RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262869.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-62DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLU5FTN21e-138U5FTN2_POPTR; Uncharacterized protein
STRINGPOPTR_0012s05720.11e-138(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.12e-68MYB family protein